United States - Post Free Ads

United States , New York , New York  

UNITED STATES CLASSIFIED ADS. POST FREE ADS

View Larger Map

www.AppShrink.com is your source for app reviews

Location : New York, New York, United States
Posted by : Irene_777 ( View user all ads )
Posted On : Jan 31, 2013
Ad Type : Offered

Get Your App Reviewed on AppShrink.com

 

www.AppShrink.com  is your source for app reviews, tech tips and tricks, news, and of course a platform to advertise your app. We offer a variety of packages at very competitive prices to fit everyone needs and budget.

 

We have a variety of advertising option to suit your needs and budget. Check out our great offers to help you increase sales and profitability today!

 

Our Google PageRank is currently 4 and on average we expect about 30,000 page views per month. Our lead time on average is between 1-2 weeks. We have expedited reviews in 24-48 hours for an additional $20.

 

Review Package $40

● Written Review of your app by AppShrink.com

● 14-Day Sidebar Featured Section Placement (AdBlock Safe)

● 600x400px Featured Banner on the home page (provided by you) (AdBlock Safe)

● Link to review posted to Twitter

● Link to review posted to Facebook

● One “DoFollow” Link to the your app’s App Store page included in the review (*Additional links to any domain are available upon request at $20 each.)

 

Video Package $60

● 1080p Full HD Video Review / Demo filmed by AppShrink.com

● Extended and complete distribution of the video to the following channels:

 

- YouTube Channel

- Blip.tv Channel

- iTunes Video Podcasts

- Roku TV Channel

- Boxee TV Channel

- PopBox TV Channel

- AOL Video

- Mefeedia

- Blinkx

 

● 28-Day Sidebar Featured Section Placement (AdBlock Safe)

● 600x400px Featured Banner on the home page (provided by you) (AdBlock Safe)

● Link to video posted to Twitter

● Link to video posted to Facebook

● One “DoFollow” Link to your app’s in App Store page included in the review (*Additional links to any domain are available upon request at $20 each.)

increasesaleshelpoffersmonthcheckneedsappshrinksourceappreviewsreviewedtechtipstricksnewscourseplatformadvertiseoffervarietypackagescompetitivepricesfiteveryonebudgetadvertisingoptionsuitoutgreatprofitabilitytodaygooglepagerankcurrentlyaverageexpectpageviewsleadtimebetweenweeksexpeditedhoursadditionalreviewpackagewrittendaysidebarfeaturedsectionplacementadblocksafe600x400pxbannerhomeprovidedlinkpostedtwitterfacebookdofollowstoreincludedlinksdomainavailableuponrequesteachvideo1080pdemofilmedextendedcompletedistributionfollowingchannelsyoutubechannelblipitunespodcastsrokuboxeepopboxaolmefeediablinkx
Business to Business &raqu...
4 months ago
United States - Post Free Ads
United States , New York , New York
More Cities

UNITED STATES CLASSIFIED ADS. POST FREE ADS