United States - Post Free Ads

United States , Arizona , Arivaca  

UNITED STATES CLASSIFIED ADS. POST FREE ADS

View Larger Map

This World Has Many Remedies for Getting Rid of Pimples

Location : Hamilton, Bermuda,HM09,USA Arivaca, Arizona, United States
Posted by : Getridofacn1 ( View user all ads )
Posted On : Mar 7, 2013

Acne must be one of the most heated skin diseases ever. Acne is like the body’s signal that a person is about to reach puberty and adulthood. Well, it is not known for certain as to what age acne finally disappears, there have been cases where people with ages 40 and above continue to have acne. Acne is so bad other people that they actually consider having it as suffering. And due to desperation and frustration, they often equate pricking as one of the remedies for getting rid of pimples. The problem is, it’s not, and it also leads to scars. One of best natural remedy to acne is by applying egg whites on the face for a few minutes. That sticky, more or less, clear substance is actually full of amino acids and protein. These two are great in tightening the pores of the skin, which give pimples a hard time to sprout. If done for two to three weeks, it may even lighten the scars. Another way of preventing pimples, so you don’t have to Google-search a natural remedy to acne, is by use of baking soda. People consider this as rough on the skin, but actually they’re not. Think of baking soda as sandpaper is to wood. Before applying it, wet the baking soda into a paste, and then feel free to put this on your face by massage. This paste removes the dead skin cells, so remember to exfoliate afterwards. Another type of natural remedy to acne is lemon juice. Of course, the fresher the juice the better it is.A lemon juice, believe it or not, is a great disinfectant because of its acidic content.

Naturally, lemon juice when dabbed on the face will destroy the bacteria that cause acne. It is also great for exfoliation, but people with sensitive skin should be warned that they might experience a stinging effect.Don’t worry because as soon as the skin gets used to the lemon juice, this will eventually disappear. Some people actually grow frustrated with their acne and prick these. Now, pricking can only result to scarring of the skin, but they can use Aloe Vera juice to smoothen and remove these scars as well as boost the body’s immune system. In fact, it also regenerates damaged tissue. If acne does occur, the persistent use of Aloe Vera juice will keep the swelling to a minimum size. It is also easy to buy. Remedies for getting rid of pimples also include olive oil. Now, olive oil is like the lemon juice. It is simply packed with iron and scores of other vitamins like A, D, E, C, B1 and B2, which helps the skin in maintaining its smoothness. Vitamin E is also present on olive oil, which everyone in the beauty industry knows is an important vitamin that helps lessen the aging of the body. By being rich in anti-oxidants, it can lessen and remove existing acnes, while removing the dirt in the face with every wash. Remedies for getting rid of pimples are not the only use for olive oil. Because of its high vitamin content, it is also a very good natural scar remover.

worldmanyremediesgettingridpimplesacnemustheatedskindiseasesbodysignalpersonreachpubertyadulthoodwellknowncertainagefinallydisappearsbeencasespeopleagesabovecontinuebadotheractuallyconsiderhavingsufferingduedesperationfrustrationoftenequateprickingproblemleadsscarsbestnaturalremedyapplyingeggwhitesfacefewminutesstickylessclearsubstanceaminoacidsproteingreattighteningporeswhichhardtimesproutdonethreeweeksevenlightenanotherwaypreventingdongooglesearchusebakingsodaroughthinksandpaperwoodbeforewetpastefeelfreemassageremovesdeadcellsrememberexfoliateafterwardstypelemonjuicecoursefresherbetterbelievedisinfectantbecauseacidiccontentnaturallywhendabbeddestroybacteriacauseexfoliationsensitiveshouldwarnedmightexperiencestingingeffectworrysoongetsusedeventuallydisappearsomegrowfrustratedprickresultscarringaloeverasmoothenremoveboostimmunesystemfactregeneratesdamagedtissuedoesoccurpersistentkeepswellingminimumsizeeasybuyincludeoliveoilsimplypackedironscoresvitaminshelpsmaintainingsmoothnessvitaminpresenteveryonebeautyindustryknowsimportantlessenagingbeingrichantioxidantsexistingacneswhileremovingdirteverywashhighgoodscarremover
United States - Post Free Ads
United States , Arizona , Arivaca
More Cities

UNITED STATES CLASSIFIED ADS. POST FREE ADS